Skip to Content

ELISA Recombinant Yponomeuta malinellus Cytochrome c oxidase subunit 2(COII)

https://www.kxtbio.com/web/image/product.template/162102/image_1920?unique=7c948e0
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Yponomeuta malinellus (European small ermine moth) (Apple ermine moth) Uniprot NO.:P98048 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MATWNNLNLQNGASPLMEQIIFFHDHTLIILIMITILVGYLMINLFFNKYINRFLLEGQM IELIWTILPAITLIFIALPSLRLLYLLDELNNPLITLKSIGHQWYWSYEYSDFNNIQFDS YMIPSKEMKFNEFRLLDVDNRIILPMNNQIRIMVTATDVIHSWTVPSLGVKIDANPGRLN QTNFFINRPGLFYGQCSEICGANHSFMPIVIESISINNFIKWINNYSS Protein Names:Recommended name: Cytochrome c oxidase subunit 2 EC= 1.9.3.1 Alternative name(s): Cytochrome c oxidase polypeptide II Gene Names:Name:COII Expression Region:1-228 Sequence Info:fµLl length protein

1,576.00 € 1576.0 EUR 1,576.00 €

1,576.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days