Skip to Content

ELISA Recombinant Zaglossus bruijni NADH-ubiquinone oxidoreductase chain 1(MT-ND1)

https://www.kxtbio.com/web/image/product.template/162103/image_1920?unique=7c948e0
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Zaglossus bruijni (Long-beaked echidna) Uniprot NO.:O78713 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:ILLAVAFLTLIERKILGYMQFRKGPNIVGPHGLLQPIADAVKLFIKEPLRPMTSSIYMFI LAPILALSLALTIWVPLPMPLPLIDLNLGLLFVLSVSGLSVYSILWSGWASNSKYALTGA LRAVAQTISYEVTLAIILLSImLINGSFTLTTLNLTQEFMWLVVPTWPLmLTRFISTLAE TNRAPFDLTEGESELVSGFNVEYAAGPFAMFFLAEYANIIIMNALTVILFFGAYHLIFLP ELSTINFMIKTMmLTSLFLWIRASYPRFRYDQLMHLLWKNFLPITLVTCLWFImLPLALS WIP Protein Names:Recommended name: NADH-ubiquinone oxidoreductase chain 1 EC= 1.6.5.3 Alternative name(s): NADH dehydrogenase subunit 1 Gene Names:Name:MT-ND1 Synonyms:MTND1, NADH1, ND1 Expression Region:1-303 Sequence Info:fµLl length protein

1,655.00 € 1655.0 EUR 1,655.00 €

1,655.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days


Internal Reference: CSB-CF015076ZAR-GB