ELISA Recombinant Macaca fascicularis NADH-ubiquinone oxidoreductase chain 5(MT-ND5)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Macaca fascicµLaris (Crab-eating macaque) (Cynomolgus monkey) Uniprot NO.:P50665 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MIMHTPIMMTTLISLTLPIFATLTNPYKKRSYPDYVKTTVMYAFITSLPSTTLFILSNQE TTIWSWHWMTTQTLDLTLS Protein Names:Recommended name: NADH-ubiquinone oxidoreductase chain 5 EC= 1.6.5.3 Alternative name(s): NADH dehydrogenase subunit 5 Gene Names:Name:MT-ND5 Synonyms:MTND5, NADH5, ND5 Expression Region:1-79 Sequence Info:fµLl length protein