Skip to Content

ELISA Recombinant Xenopus tropicalis Zinc transporter ZIP14(slc39a14)

https://www.kxtbio.com/web/image/product.template/161640/image_1920?unique=7c948e0
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Xenopus tropicalis (Western clawed frog) (Silurana tropicalis) Uniprot NO.:A4IGY6 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:GPTPSTGKELSAASFLQDILQRYGENESLSMPQLQSLLENLEVGKGGGNQRNMSQCLSSS TLFAAHNLTSGSVVDAEGFQSFCPTILQQLETRACQESPAFQNETTPGAEGRPSPGEVWG YGFLCVTVISLCSLFGAGVVPFMKKACYKRLLLFCIALAIGTLFSNALFQLIPEAFGFNP LEDSYVFTSSVIFGGFYLFFFTEKVLKMmLKQKHEHGHSHYSADTSKRDAEEGVTEKLQN GDLDHMIPPPHGSESDLRGDEKAVQQQDLPGQQSSCYWLKGIRYSDIGTLAWMITLSDGL HNFIDGLAIGASFTVSVFQGVSTSIAILCEEFPHELGDFVILLNAGMSIPQALFFNFLSA CCCYLGLAFGILAGSHFSSNWIFALAGGMFLYIALSDMFPEMNEVSKEDEEGGRAFSAFM IQNAGLLTGFAImLLLTTFSGQIQLG Protein Names:Recommended name: Zinc transporter ZIP14 Alternative name(s): Solute carrier family 39 member 14 Zrt- and Irt-like protein 14 Short name= ZIP-14 Gene Names:Name:slc39a14 Synonyms:zip14 Expression Region:17-462 Sequence Info:fµLl length protein

1,806.00 € 1806.0 EUR 1,806.00 €

1,806.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days