Skip to Content

ELISA Recombinant Xenopus tropicalis Transmembrane protein 47(tmem47)

https://www.kxtbio.com/web/image/product.template/161606/image_1920?unique=871b00d
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Xenopus tropicalis (Western clawed frog) (Silurana tropicalis) Uniprot NO.:Q6PBE5 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MASSASGMEEVRSSVLTPLKLVGLVCIFLALCLDIGAVLSPAWVTADNQYYLSLWESCKK AENLWICDSTLESDWQIATLALLLGGAAIILIAFLVGLISICVGSRRRFYRPVAVmLFAA VVLQVCGLVLYPIKFIETVTLKIYHEFNWGYGLAWGATIFSFGGAILYCLNPKNYEDYY Protein Names:Recommended name: Transmembrane protein 47 Alternative name(s): Transmembrane 4 superfamily member 10 Gene Names:Name:tmem47 Synonyms:tm4sf10 Expression Region:1-179 Sequence Info:fµLl length protein

1,524.00 € 1524.0 EUR 1,524.00 €

1,524.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days