ELISA Recombinant Xenopus tropicalis Transmembrane protein 97(tmem97)
Quantity:50 µg. Other Quantitys are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Xenopus tropicalis (Western clawed frog) (Silurana tropicalis)
Uniprot NO.:Q6DFQ5
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MAVCARLLEWIFFFYFFSHIPITLLVDLQAVLPPSLYPQELLDLMKWYTVAFKDHLMANP PPWFKSFVYCEAILQLPFFPVAAYAFFKGGCKWIRIPAIVYSAHVATTVIAIIGHILFGE FPKSDVIAPLTQKDRLTLVSIYAPYLLVPVLLLLTmLFSPRYRQEEKRKRK
Protein Names:Recommended name: Transmembrane protein 97
Gene Names:Name:tmem97 ORF Names:TEgg113g04.1
Expression Region:1-171
Sequence Info:fµLl length protein