ELISA Recombinant Yop proteins translocation lipoprotein J(yscJ)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Yersinia pseudotubercµLosis Uniprot NO.:P69973 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:CKVDLYTGISQKEGNEmLALLRQEGLSADKEPDKDGKIKLLVEESDVAQAIDILKRKGYP HESFSTLQDVFPKDGLISSPIEELARLNYAKAQEISRTLSEIDGVLVARVHVVLPEEQNN KGKKGVAASASVFIKHAADIQFDTYIPQIKQLVNNSIEGLAYDRISVILVPSVDVRQSSH LPRNTSILSIQVSEESKGHLIGLLSLLILLLPVTNLAQYFWLQRKK Protein Names:Recommended name: Yop proteins translocation lipoprotein J Alternative name(s): Lipoprotein ylpB Low calcium response locus protein KA Gene Names:Name:yscJ Synonyms:lcrKA, ylpB Ordered Locus Names:pYV0086 Expression Region:19-244 Sequence Info:fµLl length protein