ELISA Recombinant Yop proteins translocation protein S(yscS)
Quantity:50 µg. Other Quantitys are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Yersinia pestis
Uniprot NO.:P69982
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MSQGDIIHFTSQALWLVLVLSMPPVLVAAVVGTLVSLVQALTQIQEQTLGFVIKLIAVVV TLFATASWLGNELHSFAEMTMMKIQGIR
Protein Names:Recommended name: Yop proteins translocation protein S
Gene Names:Name:yscS Ordered Locus Names:YPCD1.45, y5033, y0036, YP_pCD38
Expression Region:1-88
Sequence Info:fµLl length protein