ELISA Recombinant Yop proteins translocation protein T(yscT)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Yersinia pseudotubercµLosis Uniprot NO.:P69985 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MIADLIQRPLLTYTLLLPRFMACFVILPVLSKQLLGGVLLRNGIVCSLALYVYPAVANQP YIEVDAFTLmLLIGKEIILGLLIGFVATIPFWALESAGFIVDNQRGAAMASLLNPGLDSQ TSPTGLLLTQTLITIFFSGGAFLSLLSALFHSYVNWPVASFFPAVSEQWVDFFYNQFSQI LLIAAVLAAPLLIAMFLAEFGLALISRFAPSLNVFVLAMPIKSAIASLLLVIYCMQMMSH ASKAmLLVMDPISLLIPVLEK Protein Names:Recommended name: Yop proteins translocation protein T Gene Names:Name:yscT Ordered Locus Names:pYV0073 Expression Region:1-261 Sequence Info:fµLl length protein