ELISA Recombinant Yop proteins translocation lipoprotein J(yscJ)
Quantity:50 µg. Other Quantitys are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Yersinia pestis
Uniprot NO.:P69972
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:CKVDLYTGISQKEGNEmLALLRQEGLSADKEPDKDGKIKLLVEESDVAQAIDILKRKGYP HESFSTLQDVFPKDGLISSPIEELARLNYAKAQEISRTLSEIDGVLVARVHVVLPEEQNN KGKKGVAASASVFIKHAADIQFDTYIPQIKQLVNNSIEGLAYDRISVILVPSVDVRQSSH LPRNTSILSIQVSEESKGHLIGLLSLLILLLPVTNLAQYFWLQRKK
Protein Names:Recommended name: Yop proteins translocation lipoprotein J Alternative name(s): Lipoprotein ylpB Low calcium response locus protein KA
Gene Names:Name:yscJ Synonyms:lcrKA, ylpB Ordered Locus Names:YPCD1.59, y5019, y0022, YP_pCD24
Expression Region:19-244
Sequence Info:fµLl length protein