ELISA Recombinant Yop proteins translocation protein R(yscR)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Yersinia pestis Uniprot NO.:P69980 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MIQLPDEINLIIVLSLLTLLPLISVMATSFVKFAVVFSLLRNALGVQQIPPNMAMYGLAI ILSLYVMAPVGFATQDYLQANEVSLTNIESVEKFFDEGLAPYRMFLKQHIQAQEYSFFVD STKQLWPKQYADRLESDSLFILLPAFTVSELTRAFEIGFLIYLPFIVIDLVISNILLAMG MMMVSPMTISLPFKLLLFVLLDGWTRLTHGLVISYGG Protein Names:Recommended name: Yop proteins translocation protein R Gene Names:Name:yscR Ordered Locus Names:YPCD1.44, y5034, y0037, YP_pCD39 Expression Region:1-217 Sequence Info:fµLl length protein