ELISA Recombinant Zea mays Oleosin Zm-I(OLE16)
Quantity:50 µg. Other Quantitys are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Zea mays (Maize)
Uniprot NO.:P13436
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:ADHHRGATGGGGGYGDLQRGGGMHGEAQQQQKQGAMMTALKAATAATFGGSmLVLSGLIL AGTVIALTVATPVLVIFSPVLVPAAIALALMAAGFVTSGGLGVAALSVFSWMYKYLTGKH PPAADQLDHAKARLASKARDVKDAAQHRIDQAQGS
Protein Names:Recommended name: Oleosin Zm-I Alternative name(s): Lipid body-associated major protein Lipid body-associated protein L3 Oleosin 16 kDa
Gene Names:Name:OLE16 Synonyms:OLE1
Expression Region:2-156
Sequence Info:fµLl length protein