Skip to Content

ELISA Recombinant Zea mays Oleosin Zm-I(OLE16)

https://www.kxtbio.com/web/image/product.template/162226/image_1920?unique=7c948e0
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Zea mays (Maize) Uniprot NO.:P13436 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:ADHHRGATGGGGGYGDLQRGGGMHGEAQQQQKQGAMMTALKAATAATFGGSmLVLSGLIL AGTVIALTVATPVLVIFSPVLVPAAIALALMAAGFVTSGGLGVAALSVFSWMYKYLTGKH PPAADQLDHAKARLASKARDVKDAAQHRIDQAQGS Protein Names:Recommended name: Oleosin Zm-I Alternative name(s): Lipid body-associated major protein Lipid body-associated protein L3 Oleosin 16 kDa Gene Names:Name:OLE16 Synonyms:OLE1 Expression Region:2-156 Sequence Info:fµLl length protein

1,499.00 € 1499.0 EUR 1,499.00 €

1,499.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days