Skip to Content

ELISA Recombinant Yarrowia lipolytica Glyoxylate pathway regulator(GPR1)

https://www.kxtbio.com/web/image/product.template/161706/image_1920?unique=7c948e0
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Yarrowia lipolytica (strain CLIB 122 / E 150) (Yeast) (Candida lipolytica) Uniprot NO.:P41943 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MNTEIPDLEKQQIDHNSGSDDPQPIHDDMAPVSRIRSSGPNHEYIHIADQKFHRDDFYRA FGGTLNPGGAPQPSRKFGNPAPLGLSAFALTTLVFSLCTVQARGVPNPSIAVGLALFYGG VCQFAAGMWEFVQENTFGAAALTSYGGFWMSWAAIEMNAFGIKDSYNDPIEVQNAVGIYL FGWFIFTLmLTLCTLKSTVAFFGLFFmLMMTFLVLACANVTQHHGTAIGGGWLGIITAFF GFYNAYAGLANPGNSYIVPVPLDMPFVKKD Protein Names:Recommended name: Glyoxylate pathway regµLator Gene Names:Name:GPR1 Ordered Locus Names:YALI0C23617g Expression Region:1-270 Sequence Info:fµLl length protein

1,620.00 € 1620.0 EUR 1,620.00 €

1,620.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days