Skip to Content

ELISA Recombinant Yellow fever virus Genome polyprotein

https://www.kxtbio.com/web/image/product.template/161748/image_1920?unique=7c948e0
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Yellow fever virus (isolate Peru/1899/1981) (YFV) Uniprot NO.:P29165 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSGRKAQGKTLGVNMVRQGVRSLSNKIKQKTKQIGNRPGPSRGVQGFIFFFLFNVLTGRK ITAHLKKLWRmLDPRQGLAVLKKVKRVVASLMRGLSSRKRR Protein Names:Recommended name: Genome polyproteinCleaved into the following 7 chains: 1. Capsid protein CAlternative name(s): Core protein prM Peptide pr Small envelope protein MAlternative name(s): Matrix protein Envelope protein E Non-stru Gene Names: Expression Region:1-101 Sequence Info:fµLl length protein

1,442.00 € 1442.0 EUR 1,442.00 €

1,442.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days