Skip to Content

ELISA Recombinant Zea mays Cytochrome b-c1 complex subunit Rieske, mitochondrial

https://www.kxtbio.com/web/image/product.template/162211/image_1920?unique=7c948e0
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Zea mays (Maize) Uniprot NO.:P49727 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:STETVVPRNQDAGLADLPATVAAVKNPNPKVVYDEYNHERYPPGDPSKRAFAYFVLSGGR FIYASLLRLLVLKFVLSMSASKDVLALASLEVDLSSIEPGTTVTVKWRGKPVFIRRRTED DIKLANSVDVASLRHPEQDAERVKNPEWLVVIGVCTHLGCIPLPNAGDFGGWFCPCHGSH YDISGRIRKGPAPFNLEVPTYSFLEENKLLVG Protein Names:Recommended name: Cytochrome b-c1 complex subunit Rieske, mitochondrial EC= 1.10.2.2 Alternative name(s): Complex III subunit 5 Rieske iron-sµLfur protein Short name= RISP Ubiquinol-cytochrome c reductase iron-sµLfur subunit Gene Names: Expression Region:62-273 Sequence Info:fµLl length protein

1,559.00 € 1559.0 EUR 1,559.00 €

1,559.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days