ELISA Recombinant sn-glycerol-3-phosphate transport system permease protein ugpA(ugpA)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Escherichia coli O1:K1 / APEC Uniprot NO.:A1AGY3 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSSSRPVFRSRWLPYLLVAPQLIITVIFFIWPAGEALWYSLQSVDPFGFSSQFVGLDNFV TLFHDSYYLDAFWTTIKFSTFVTVSGLLVSLFFAALVEYIVRGSRFYQTLmLLPYAVAPA VAAVLWIFLFNPGRGLITHFLAEFGYDWNHAQNSGQAMFLVVFASVWKQISYNFLFFYAA LQSIPRSLIEAAAIDGAGPIRRFFKIALPLIAPVSFFLLVVNLVYAFFDTFPVIDAATSG GPVQATTTLIYKIYREGFTGLDLASSAAQSVVLMFLVIVLTVVQFRYVESKVRYQ Protein Names:Recommended name: sn-glycerol-3-phosphate transport system permease protein µgpA Gene Names:Name:µgpA Ordered Locus Names:Ecok1_34290 ORF Names:APECO1_3007 Expression Region:1-295 Sequence Info:fµLl length protein