Skip to Content

ELISA Recombinant Yersinia enterocolitica serotype O:8 - biotype 1B UPF0059 membrane protein YE1772 (YE1772)

https://www.kxtbio.com/web/image/product.template/161791/image_1920?unique=7c948e0
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Yersinia enterocolitica serotype O:8 / biotype 1B (strain 8081) Uniprot NO.:A1JM85 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MNLSATLVLAFAMSMDAFAASIGKGASLHKPRFREAIRTGLIFGVIEAITPLIGWCIGLF ASQYILEWDHWIAFSLLFILGCRMIFEGAKQQVEETEKMRSHSFWVLVMTAIATSLDAMA IGVGLAFLQVNIVHTAMAIGLATMIMATLGmLIGRYIGPLLGKRAEIIGGIVLIGIGFNI LYEHIYRLA Protein Names:Recommended name: UPF0059 membrane protein YE1772 Gene Names:Ordered Locus Names:YE1772 Expression Region:1-189 Sequence Info:fµLl length protein

1,534.00 € 1534.0 EUR 1,534.00 €

1,534.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days


Internal Reference: CSB-CF374685YAK