ELISA Recombinant Yersinia enterocolitica serotype O:8 - biotype 1B Spermidine export protein MdtI(mdtI)
Quantity:50 µg. Other Quantitys are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Yersinia enterocolitica serotype O:8 / biotype 1B (strain 8081)
Uniprot NO.:A1JRE5
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MQQLEFYHIAFLILAVILEIIANILLKMSDGFRRVWLGILSLLSVLGAFSALAQAVKGIE LSVAYALWGGFGIAATVAAGWILFNQRLNYKGWIGLILLLAGMVMIKLS
Protein Names:Recommended name: Spermidine export protein MdtI
Gene Names:Name:mdtI Ordered Locus Names:YE2380
Expression Region:1-109
Sequence Info:fµLl length protein