ELISA Recombinant Zinnia elegans CLAVATA3-ESR (CLE)-related protein TDIF
Quantity:50 µg. Other Quantitys are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Zinnia elegans (Zinnia)
Uniprot NO.:A1EC31
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:KLRSTSQISHFTNPRSCSSLFFVALLIITILITmLQSSTSMEVTSLPTHQPTSSNSHDES STSSTATTTTDLHPKRTHHQSHPKPTRSFEAGAHEVPSGPNPISNR
Protein Names:Recommended name: CLAVATA3/ESR (CLE)-related protein TDIF Alternative name(s): Tracheary element differentiation inhibitory factor Cleaved into the following chain: 1. TDIFp
Gene Names:Name:TDIF
Expression Region:27-132
Sequence Info:fµLl length protein