Skip to Content

ELISA Recombinant Zinnia elegans CLAVATA3-ESR (CLE)-related protein TDIF

https://www.kxtbio.com/web/image/product.template/162247/image_1920?unique=7c948e0
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Zinnia elegans (Zinnia) Uniprot NO.:A1EC31 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:KLRSTSQISHFTNPRSCSSLFFVALLIITILITmLQSSTSMEVTSLPTHQPTSSNSHDES STSSTATTTTDLHPKRTHHQSHPKPTRSFEAGAHEVPSGPNPISNR Protein Names:Recommended name: CLAVATA3/ESR (CLE)-related protein TDIF Alternative name(s): Tracheary element differentiation inhibitory factor Cleaved into the following chain: 1. TDIFp Gene Names:Name:TDIF Expression Region:27-132 Sequence Info:fµLl length protein

1,447.00 € 1447.0 EUR 1,447.00 €

1,447.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days