ELISA Recombinant Yersinia pestis Spermidine export protein MdtI(mdtI)
Quantity:50 µg. Other Quantitys are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Yersinia pestis (strain Pestoides F)
Uniprot NO.:A4TJI9
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MQQLEFYPIAFLILAVmLEIVANILLKMSDGFRRKWLGILSLLSVLGAFSALAQAVKGIE LSVAYALWGGFGIAATVAAGWILFNQRLNYKGWIGLILLLAGMVMIKLS
Protein Names:Recommended name: Spermidine export protein MdtI
Gene Names:Name:mdtI Ordered Locus Names:YPDSF_1053
Expression Region:1-109
Sequence Info:fµLl length protein