Skip to Content

ELISA Recombinant Yersinia pestis Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase(arnC)

https://www.kxtbio.com/web/image/product.template/161840/image_1920?unique=7c948e0
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Yersinia pestis (strain Pestoides F) Uniprot NO.:A4TIM3 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSLNEPIKKVSIVIPVYNEQESLPALIDRTTAACKLLTQAYEIILVDDGSSDNSTELLTA AANDPDSHIIAILLNRNYGQHSAIMAGFNQVSGDLIITLDADLQNPPEEIPRLVHVAEEG YDVVGTVRANRQDSLFRKTASRMINMMIQRATGKSMGDYGCmLRAYRRHIVEAmLHCHER STFIPILANTFARRTTEITVHHAEREFGNSKYSLMRLINLMYDLITCLTTTPLRLLSLVG SAIALLGFTFSVLLVALRLIFGPEWAGGGVFTLFAVLFMFIGAQFVGMGLLGEYIGRIYN DVRARPRYFVQKVVGAEQTENNQDVEK Protein Names:Recommended name: Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase EC= 2.7.8.30 Alternative name(s): Undecaprenyl-phosphate Ara4FN transferase Short name= Ara4FN transferase Gene Names:Name:arnC Ordered Locus Names:YPDSF_0729 Expression Region:1-327 Sequence Info:fµLl length protein

1,680.00 € 1680.0 EUR 1,680.00 €

1,680.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days