Skip to Content

ELISA Recombinant Yersinia pestis Fumarate reductase subunit C(frdC)

https://www.kxtbio.com/web/image/product.template/161817/image_1920?unique=7c948e0
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Yersinia pestis (strain Pestoides F) Uniprot NO.:A4TRQ4 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MTTKRKAYVRTMAPNWWQQLGFYRFYmLREGTSIPAVWFSVLLIYGVFALKSGPAGWEGF VSFLQNPLVLFLNILTLFAALLHTKTWFELAPKAVNIIVKSEKMGPEPMIKALWVVTVVA SAIILAVALL Protein Names:Recommended name: Fumarate reductase subunit C Alternative name(s): Fumarate reductase 15 kDa hydrophobic protein Gene Names:Name:frdC Ordered Locus Names:YPDSF_3616 Expression Region:1-130 Sequence Info:fµLl length protein

1,472.00 € 1472.0 EUR 1,472.00 €

1,472.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days