ELISA Recombinant Yersinia pseudotuberculosis serotype O:1b UPF0756 membrane protein YpsIP31758_1251 (YpsIP31758_1251)
Quantity:50 µg. Other Quantitys are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Yersinia pseudotubercµLosis serotype O:1b (strain IP 31758)
Uniprot NO.:A7FG53
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MAALDPTLLILLALAALGILSHNMTVTLAILILIAIRITPLNSFFPWVEKYGLTIGVLIL TIGVMAPIASGKISASEVLHSFVQWKSILAIVVGVAVSWLGGRGVSLMTHQPSVVAGLLV GTVLGVALFKGVPVGPLIAAGLLSLVIGKS
Protein Names:Recommended name: UPF0756 membrane protein YpsIP31758_1251
Gene Names:Ordered Locus Names:YpsIP31758_1251
Expression Region:1-150
Sequence Info:fµLl length protein