Skip to Content

ELISA Recombinant Yersinia pseudotuberculosis serotype O:1b Spermidine export protein MdtJ(mdtJ)

https://www.kxtbio.com/web/image/product.template/162054/image_1920?unique=7c948e0
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Yersinia pseudotubercµLosis serotype O:1b (strain IP 31758) Uniprot NO.:A7FIB5 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MIYWIFLGLAIIAEIIGTLSMKYASVSGEMTGHIVMYFMITGSYVmLSLAVKKVALGVAY ALWEGIGILIITIFSVMWFGETLSPLKIAGLVTLIGGILLVKSGTRKPKQPNRHRGNRPP SVQGLKTQTTGHHKGVAVESGEHHAAA Protein Names:Recommended name: Spermidine export protein MdtJ Gene Names:Name:mdtJ Ordered Locus Names:YpsIP31758_2020 Expression Region:1-147 Sequence Info:fµLl length protein

1,490.00 € 1490.0 EUR 1,490.00 €

1,490.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days