ELISA Recombinant Zinc finger protein-like 1 homolog (CBG06644)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Caenorhabditis briggsae Uniprot NO.:A8X2R2 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MGLCKCPKRKVTNLFCYEHRVNVCEFCLVDNHPNCVVQSYLNWLTDQDYDPNCSLCHTTL TQGETIRLNCLHLLHWRCFDDWAASFPPTTAPAGYRCPCCSQEVFPPINEVSPLIEKLRE QLKQSNWARNALGLPVLPELNRPVKNIAPIPPPPPPQVKHVSYDDSPAQKEIPIHHNRSE TPATHLEMEDTASYSVSNSDVTFARKKNFASESSSDTRPLLRQDRDADNEENKYKRRPTI DWMRGLWRAKHGTGVPEDRTSGRKMAIFVMFLALLALITIITVLKRAGYNGEHSSDPMFD PMANPNIRVAVDDSRLPHL Protein Names:Recommended name: Zinc finger protein-like 1 homolog Gene Names:ORF Names:CBG06644 Expression Region:1-319 Sequence Info:fµLl length protein