ELISA Recombinant Yersinia pestis bv. Antiqua Probable intracellular septation protein A (YpAngola_A2326)
Quantity:50 µg. Other Quantitys are also available.
Product Type:Recombinant Protein
Species:Yersinia pestis bv. Antiqua (strain Angola)
Uniprot NO.:A9R9A2
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MKQLLDFLPLVVFFIFYKMYDIFVASGALIVATLVALAFTWLKYRKVEKMTLVTAAMVLV FGTLTLAFHSDLFIKWKVTVLYVLFALALLVSQWVMKKPLIQRmLGKELTLPDKVWSTLN LSWAIFFLVCGLLNIYVAFWLPQDIWVNFKVFGLTALTLIFTLISGVYIYRHMPEEQKKS
Protein Names:Recommended name: Probable intracellµLar septation protein A
Gene Names:Ordered Locus Names:YpAngola_A2326
Expression Region:1-180
Sequence Info:fµLl length protein