Skip to Content

ELISA Recombinant Yersinia pseudotuberculosis serotype IB UPF0761 membrane protein YPTS_0028 (YPTS_0028)

https://www.kxtbio.com/web/image/product.template/162027/image_1920?unique=7c948e0
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Yersinia pseudotubercµLosis serotype IB (strain PB1/+) Uniprot NO.:B2JYL3 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MASFRRFRLLSPLKPCVTFGRmLYTRIDKDGLTmLAGHLAYVSLLSLVPLITVIFALFAA FPMFAEISIKLKAFIFANFIPATGDIIQNYLEQFVANSNRMTVVGTCGLIVTALLLIYSV DSVLNIIWRSKIQRSLVFSFAVYWMVLTLGPILVGASMVISSYLLSLHWLAHARVDSMID EILRVFPLLISWVSFWLLYSVVPTVRVPARDALIGALVAALLFELGKKGFAMYITLFPSY QLIYGVLAVIPILFLWVYWSWCIVLLGAEITVTLGEYRAERHHAKSVITQSPEM Protein Names:Recommended name: UPF0761 membrane protein YPTS_0028 Gene Names:Ordered Locus Names:YPTS_0028 Expression Region:1-294 Sequence Info:fµLl length protein

1,645.00 € 1645.0 EUR 1,645.00 €

1,645.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days