ELISA Recombinant Cupriavidus taiwanensis Protein CrcB homolog(crcB)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Cupriavidus taiwanensis (strain R1 / LMG 19424) (Ralstonia taiwanensis (strain LMG 19424)) Uniprot NO.:B3R2M9 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MGPLGFVAVGVGAAAGAWLRWGFSVLWNAINPAMPYGTLAANLLGGYLIGLAVGFFDTHA GLPPEWRLLAITGFLGGLTTFSTFSSEVVANLIAGDYGWAAMHLLLHLGGSLLLTALGLW TYRmLA Protein Names:Recommended name: Protein CrcB homolog Gene Names:Name:crcB Ordered Locus Names:RALTA_A1805 Expression Region:1-126 Sequence Info:fµLl length protein