Skip to Content

ELISA Recombinant Zea mays CASP-like protein 8

https://www.kxtbio.com/web/image/product.template/162191/image_1920?unique=7c948e0
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Zea mays (Maize) Uniprot NO.:B6TGJ8 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MAFTSLLGSDAERKVAVAEVALRAVLCGLGALAAALVATDTQTRTFFSLQKKATYTDMKA MVLLVAAAAAAAGYSLLQAARCCCCVALLRTSIRPRARLLLAWCVFACDQALAYALLAAV VAALQASVVAKQGLPQLQWMAICALYGAFCRQAGAGVACAVAAAVDAALLAFLSAFNLFR LYGAKATTTT Protein Names:Recommended name: CASP-like protein 8 Gene Names: Expression Region:1-190 Sequence Info:fµLl length protein

1,536.00 € 1536.0 EUR 1,536.00 €

1,536.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days