Skip to Content

ELISA Recombinant Uncharacterized membrane protein yrzS(yrzS)

https://www.kxtbio.com/web/image/product.template/114666/image_1920?unique=871b00d
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Bacillus subtilis Uniprot NO.:C0H463 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MTEFPKIIMILGAVLLIIGAVLHFVGKMPGDIFVKKGNVTFFFPVVTCIIISVVLSILLN LFGRMK Protein Names:Recommended name: Uncharacterized membrane protein yrzS Gene Names:Name:yrzS Ordered Locus Names:BSU27729 Expression Region:1-66 Sequence Info:fµLl length protein

1,405.00 € 1405.0 EUR 1,405.00 €

1,405.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days