ELISA Recombinant Zygosaccharomyces rouxii Altered inheritance of mitochondria protein 31, mitochondrial(AIM31)
Quantity:50 µg. Other Quantitys are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Zygosaccharomyces rouxii (strain ATCC 2623 / CBS 732 / NBRC 1130 / NCYC 568 / NRRL Y-229) (Candida mogii)
Uniprot NO.:C5DWC4
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MSGLPSSFDSKEASVDELPFLEKVKFHCKQQPLVPLGTLLTTGAVALAAQNVRTGNKKKA QVWFRWRVGLQAATLVALVAGSFIYGSSLKEKKSEEEKMREKAKMRELLWIQELERRDQE TQYRRKRAELARQKMQENEAAVSRLQKELKDLESHIKNEK
Protein Names:Recommended name: Altered inheritance of mitochondria protein 31, mitochondrial
Gene Names:Name:AIM31 Ordered Locus Names:ZYRO0D13684g
Expression Region:1-160
Sequence Info:fµLl length protein