Skip to Content

ELISA Recombinant Zygosaccharomyces rouxii Golgi to ER traffic protein 2(GET2)

https://www.kxtbio.com/web/image/product.template/162281/image_1920?unique=7c948e0
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Zygosaccharomyces rouxii (strain ATCC 2623 / CBS 732 / NBRC 1130 / NCYC 568 / NRRL Y-229) (Candida mogii) Uniprot NO.:C5DTJ3 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSELSDAEKRRILKERRQKKFGSGGGTNRLNKITGQADSLMSTESTLDQRERTPEAAINT RQNEAGNNQSTTDNNPQVSLLKQLAEQDRQEGSEAPPDLMSmLQSMTGGDAKNGTPPTLG TPPAPVDQSmLDYHNYLVNRLKAWSIIIKWIVLLPYMYVVTHDVPLSLPFGLMDSSNFFS VLMGFEIVATSIYYKRLQSIEKGTSVNTMMHGSMIAKLISLIPDQAPQQKNLKSRLFTLL QYWDVVSmLITDICFVLVVLGIFTHI Protein Names:Recommended name: Golgi to ER traffic protein 2 Gene Names:Name:GET2 Ordered Locus Names:ZYRO0C09020g Expression Region:1-266 Sequence Info:fµLl length protein

1,616.00 € 1616.0 EUR 1,616.00 €

1,616.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days