ELISA Recombinant Zygosaccharomyces rouxii Altered inheritance of mitochondria protein 36, mitochondrial(AIM36)
Quantity:50 µg. Other Quantitys are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Zygosaccharomyces rouxii (strain ATCC 2623 / CBS 732 / NBRC 1130 / NCYC 568 / NRRL Y-229) (Candida mogii)
Uniprot NO.:C5DQ08
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:ASKPAKPAARNNTGPGFAMIFALAIIGTVIFNETAKNLDKNKPRNTFTEEEYEHVMQGLK RRVAMFPDGQLDVQFSLQKDSTQLKKLLGDSKLYIDPGQVVENYRSDREDPYEPLLNEVY SKYGPEYLKYLPQGLLVSLLGRYMKAHCRQGDHVVILDFPHSIKDAIKFENEVSSASKLL VPKESLDSDVCKYYQTVQKSQQL
Protein Names:Recommended name: Altered inheritance of mitochondria protein 36, mitochondrial Alternative name(s): Found in mitochondria protein 39
Gene Names:Name:AIM36 Synonyms:FMP39 Ordered Locus Names:ZYRO0A07700g
Expression Region:36-238
Sequence Info:fµLl length protein