ELISA Recombinant Yersinia enterocolitica subsp. palearctica serotype O:3 L-alanine exporter AlaE(alaE)
Quantity:50 µg. Other Quantitys are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Yersinia enterocolitica subsp. palearctica serotype O:3 (strain DSM 13030 / CIP 106945 / Y11)
Uniprot NO.:E7B4A5
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MTMFSTRSRLRSAAADTFALVVYCFVIGMIIEIVISGMTFQQSLSSRLVSIPVNILIAWP YGLYRDAFIRFARRHAGEHMWARNLADLLAYVSFQSPVYALILWSVGADLEQITTAVASN ALVSMAMGVAYGYFLEYCRKLFRVAGYI
Protein Names:Recommended name: L-alanine exporter AlaE
Gene Names:Name:alaE Ordered Locus Names:Y11_38941
Expression Region:1-148
Sequence Info:fµLl length protein