ELISA Recombinant Yersinia pseudotuberculosis serotype O:3 UPF0208 membrane protein YPK_1552 (YPK_1552)
Quantity:50 µg. Other Quantitys are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Yersinia pseudotubercµLosis serotype O:3 (strain YPIII)
Uniprot NO.:B1JGK5
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MTIKPSDSVSWFQVLQRGQHYMKTWPADKRLAPVFPENRVTVVTRFGIRFMPPLAIFTLT WQIALGGQLGPAIATALFACGLPLQGLWWLGKRAITPLPPTLLQWFHEVRHKLSEAGQAV APIEPIPTYQSLADLLKRAFKQLDKTFLDDL
Protein Names:Recommended name: UPF0208 membrane protein YPK_1552
Gene Names:Ordered Locus Names:YPK_1552
Expression Region:1-151
Sequence Info:fµLl length protein