Skip to Content

ELISA Recombinant Xenopus tropicalis Sodium-potassium-transporting ATPase subunit beta-1-interacting protein 3(nkain3)

https://www.kxtbio.com/web/image/product.template/161566/image_1920?unique=871b00d
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Xenopus tropicalis (Western clawed frog) (Silurana tropicalis) Uniprot NO.:Q0VFH9 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MGCCTGRCTLIFICTLQmLVALERQIFDFLGYQWAPILGNFLHIIVVILGLFGTIQYRPR YIVAYTIWTAFWVAWNVFIICFYLEVGGLSKDTDLMTFNISIHRSWWREHGPGCVWRLVP APPSKNLGDHSFISVTGCIIEFQYIEVIHSAVQILLSLIGFVYACYVISVITDEEDSCRH K Protein Names:Recommended name: Sodium/potassium-transporting ATPase subunit beta-1-interacting protein 3 Short name= Na(+)/K(+)-transporting ATPase subunit beta-1-interacting protein 3 Gene Names:Name:nkain3 Expression Region:1-181 Sequence Info:fµLl length protein

1,526.00 € 1526.0 EUR 1,526.00 €

1,526.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days