ELISA Recombinant Yersinia pestis bv. Antiqua Sulfoxide reductase heme-binding subunit YedZ(yedZ)
Quantity:50 µg. Other Quantitys are also available.
Product Type:Recombinant Protein
Species:Yersinia pestis bv. Antiqua (strain Nepal516)
Uniprot NO.:Q1CDU3
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MRLSLRHITWLKIAIWLAATLPLLWLVLSINLGGLSADPAKDIQHFTGRMALKLLLATLL VSPLARYSKQPLLLRCRRLLGLWCFAWGTLHLLSYSILELGLSNIGLLGHELINRPYLTL GIISWLVLLALALTSTRWAQRKMGARWQKLHNWVYVVAILAPIHYLWSVKTLSPWPIIYA VMAALLLLLRYKLLLPRYKKFRQWFR
Protein Names:Recommended name: SµLfoxide reductase heme-binding subunit YedZ Alternative name(s): Flavocytochrome YedZ
Gene Names:Name:yedZ Ordered Locus Names:YPN_3510 ORF Names:YP516_3985
Expression Region:1-206
Sequence Info:fµLl length protein