Skip to Content

ELISA Recombinant Yersinia pestis bv. Antiqua UPF0059 membrane protein YPA_1126(YPA_1126)

https://www.kxtbio.com/web/image/product.template/161962/image_1920?unique=7c948e0
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Yersinia pestis bv. Antiqua (strain Antiqua) Uniprot NO.:Q1C8X9 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MNLSATIILAFAMSMDAFAASIGKGATLYKPRFREALRTGLIFGVIEAITPLIGWCIGLF ASQYIMEWDHWIAFSLLFILGCRMIFEGMKQRVAETEKMRSHSFWVLVTTAIATSLDAMA IGVGLAFLQVDIVHTAMAIGLATMIMATLGmLIGRYIGPLLGKRAEIIGGIVLIGIGFNI LYEHMHLTA Protein Names:Recommended name: UPF0059 membrane protein YPA_1126 Gene Names:Ordered Locus Names:YPA_1126 Expression Region:1-189 Sequence Info:fµLl length protein

1,534.00 € 1534.0 EUR 1,534.00 €

1,534.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days