Skip to Content

ELISA Recombinant Yersinia pestis bv. Antiqua Prolipoprotein diacylglyceryl transferase(lgt)

https://www.kxtbio.com/web/image/product.template/161932/image_1920?unique=7c948e0
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Yersinia pestis bv. Antiqua (strain Nepal516) Uniprot NO.:Q1CFB4 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSNSYLAFPKFDPVIFSIGPVSLHWYGLMYLVGFVFAMWLAVRRANKPGSGWTKEEVENL LYAGFLGVFIGGRVGYVLFYNLPMFLDNPLYLFKVWDGGMSFHGGLIGVICVmLWFARRT KRNFFQVADFIAPLIPFGLGAGRLGNFINAELWGRVTTDTPWAmLFPTSRNTDIAIVAAD PAKWQAIFNQYGVLPRHPSQLYEMILEGVVLFIILNVFIRKPRPMGSVSGLFLIGYGTFR IIVECFRQPDEQLGLFEGMISMGQILSVPMILAGIIMMIWAYRRPTQKLS Protein Names:Recommended name: Prolipoprotein diacylglyceryl transferase EC= 2.4.99.- Gene Names:Name:lgt Ordered Locus Names:YPN_2989 ORF Names:YP516_3385 Expression Region:1-290 Sequence Info:fµLl length protein

1,641.00 € 1641.0 EUR 1,641.00 €

1,641.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days