ELISA Recombinant Xenopus tropicalis Vacuolar ATPase assembly integral membrane protein VMA21(vma21)
Quantity:50 µg. Other Quantitys are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Xenopus tropicalis (Western clawed frog) (Silurana tropicalis)
Uniprot NO.:Q28GR4
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MERYDKASLNAANVPLPEFSQNEGSLVATLKTLLFFTVLMImLPIGLYFSSKVYVFEGTY GMSNRDSYFYAAIVAVVAVHVVLAMFVYVAWNEGSRQWREGKQD
Protein Names:Recommended name: Vacuolar ATPase assembly integral membrane protein VMA21
Gene Names:Name:vma21 ORF Names:TEgg133e08.1
Expression Region:1-104
Sequence Info:fµLl length protein