Skip to Content

ELISA Recombinant Xenopus tropicalis Secretory carrier-associated membrane protein 5(scamp5)

https://www.kxtbio.com/web/image/product.template/161560/image_1920?unique=871b00d
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Xenopus tropicalis (Western clawed frog) (Silurana tropicalis) Uniprot NO.:Q28F21 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MAEKANNFPPLPRFIPLKPCFHQDFENDIPDLHRTTCKRLYSLWmLNSITLGVNLIGCLA WMIGGGGAINFGLAILWVILFTPCSYVCWFRPAYKAFKTDSSFNFMAFFFTFSAQLVISI IQAVGIPGWGVCGWIATVGFFGTSVGAAVVmLFPTILFTAVAVLSFVALTKVHRFYRGAG GSLSKAQEEWTTGAWKNPHVQQAAQNAAQGAMSHNDPQYSATPNYGYSNQM Protein Names:Recommended name: Secretory carrier-associated membrane protein 5 Short name= Secretory carrier membrane protein 5 Gene Names:Name:scamp5 ORF Names:TGas073j15.1 Expression Region:1-231 Sequence Info:fµLl length protein

1,579.00 € 1579.0 EUR 1,579.00 €

1,579.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days