Skip to Content

ELISA Recombinant Zygnema circumcarinatum ATP synthase subunit b, chloroplastic(atpF)

https://www.kxtbio.com/web/image/product.template/162253/image_1920?unique=7c948e0
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Zygnema circumcarinatum (Green alga) Uniprot NO.:Q32RL0 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MGERIKSTMDLLIYLQNSHLATGFGFNTNLFETNLINLAVVIGVLVYFGKGVLTTLLNNR KETIVNTIRDAEERYQEATEKLNKAYTRLEQAKAKAEEIRVNGLAQMEIEKQELIKAADE DSKRLEDSKNATLRFEEQRAIEQVRQQVSRLALELALETLKTRLNRDLHAQMIDYHIGLL QSMESVID Protein Names:Recommended name: ATP synthase subunit b, chloroplastic Alternative name(s): ATP synthase F(0) sector subunit b ATPase subunit I Gene Names:Name:atpF Expression Region:1-188 Sequence Info:fµLl length protein

1,533.00 € 1533.0 EUR 1,533.00 €

1,533.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days


Internal Reference: CSB-CF655602ZAAC