Skip to Content

ELISA Recombinant Zygnema circumcarinatum NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic(ndhG)

https://www.kxtbio.com/web/image/product.template/162261/image_1920?unique=7c948e0
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Zygnema circumcarinatum (Green alga) Uniprot NO.:Q32RK0 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MIPISESTNTLLFVVLEFAILVGALGVVLLSRVIYSALLLGFVFICVALLYLLLNADFLA AAQVLIYVGAVNVLIVFAImLVSTPDDVKNKPKTTGEIISAFTFIALFVLLTIMIFTTSW DTHHNLATQDEVLLQPLMSNVQTIGFHLLTDLLFPFELLSLLLLVALVGAITIASKNKIT E Protein Names:Recommended name: NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic EC= 1.6.5.- Alternative name(s): NAD(P)H dehydrogenase subunit 6 NADH-plastoquinone oxidoreductase subunit 6 Gene Names:Name:ndhG Expression Region:1-181 Sequence Info:fµLl length protein

1,526.00 € 1526.0 EUR 1,526.00 €

1,526.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days


Internal Reference: CSB-CF656305ZAAC