Skip to Content

ELISA Recombinant Natronomonas pharaonis Uncharacterized protein NP1057A(NP1057A)

https://www.kxtbio.com/web/image/product.template/147343/image_1920?unique=90f0e4f
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Natronomonas pharaonis (strain DSM 2160 / ATCC 35678) Uniprot NO.:Q3IUT9 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MVEIQTGLRENTVGAVEQFAEIASIDPLVASMILSGAIIITVAVVAFGALTLGAIGASIK RGLSGSEEPNQPA Protein Names:Recommended name: Uncharacterized protein NP1057A Gene Names:Ordered Locus Names:NP1057A ORF Names:NP1057E Expression Region:1-73 Sequence Info:fµLl length protein

1,412.00 € 1412.0 EUR 1,412.00 €

1,412.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days