Skip to Content

ELISA Recombinant Zea mays 1-acyl-sn-glycerol-3-phosphate acyltransferase PLS1(PLS1)

https://www.kxtbio.com/web/image/product.template/162133/image_1920?unique=7c948e0
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Zea mays (Maize) Uniprot NO.:Q41745 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MAIPLVLVVLPLGLLFLLSGLIVNAIQAVLFVTIRPFSKSFYRRINRFLAELLWLQLVWV VDWWAGVKVQLHADEETYRSMGKEHALIISNHRSDIDWLIGWILAQRSGCLGSTLAVMKK SSKFLPVIGWSMWFAEYLFLERSWAKDEKTLKWGLQRLKDFPRPFWLALFVEGTRFTPAK LLAAQEYAASQGLPAPRNVLIPRTKGFVSAVSIMRDFVPAIYDTTVIVPKDSPQPTmLRI LKGQSSVIHVRMKRHAMSEMPKSDEDVSKWCKDIFVAKDALLDKHLATGTFDEEIRPIGR PVKSLLVTLFWSCLLLFGAIEFFKWTQLLSTWRGVAFTAAGMALVTGVMHVFIMFSQAER SSSARAARNRVKKE Protein Names:Recommended name: 1-acyl-sn-glycerol-3-phosphate acyltransferase PLS1 EC= 2.3.1.51 Alternative name(s): Phospholipid synthesis protein 1 Gene Names:Name:PLS1 Expression Region:1-374 Sequence Info:fµLl length protein

1,730.00 € 1730.0 EUR 1,730.00 €

1,730.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days