Skip to Content

ELISA Recombinant Zea mays Derlin-2.2(DER2.2)

https://www.kxtbio.com/web/image/product.template/162223/image_1920?unique=7c948e0
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Zea mays (Maize) Uniprot NO.:Q4G2J3 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MAQAVEEWYRQMPIITRSYLTAAVVTTVGCTLEIISPYHLYLNPKLVVQHYEIWRLVTNF LYFRKMDLDFLFHMFFLARYCKLLEENSFRGRTADFFYmLLFGATVLTGIVLIGGMIPYI SETFARILFLSNSLTFMMVYVWSKHNPFIHMSFLGLFTFTAAYLPWVLLGFSILVGSSTW VDLLGMIAGHVYYFLEDVYPRMTGRRPLKTPSFIKALFADDNVVVAQPPNAGIGAGARFG AIGVDPQAQ Protein Names:Recommended name: Derlin-2.2 Alternative name(s): ZmDerlin2-2 Gene Names:Name:DER2.2 Expression Region:1-249 Sequence Info:fµLl length protein

1,598.00 € 1598.0 EUR 1,598.00 €

1,598.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days