Skip to Content

ELISA Recombinant Xenopus tropicalis Sugar transporter SWEET1(slc50a1)

https://www.kxtbio.com/web/image/product.template/161573/image_1920?unique=871b00d
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Xenopus tropicalis (Western clawed frog) (Silurana tropicalis) Uniprot NO.:Q5EAL3 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MDWMWLLSGACIVFTLGMFSSGLSDLRVMVAKRSVENIQFLPFLTTDLNNLGWFYYGYLK GDGTLIIVNLIGASLQTLYMAAYILYSLERRYVVSQVLVSLGVLFLAHCYFTLWTPDINS RLNQLGLFCSIFTISMYLSPLADLAQIIKSKSTKCLSFPLTVATFLTSTSWVLYGWVQSD LYITVPNFPGIVTSLLRFWLFSRYPPDQPAYSLL Protein Names:Recommended name: Sµgar transporter SWEET1 Alternative name(s): Solute carrier family 50 member 1 Gene Names:Name:slc50a1 Expression Region:1-214 Sequence Info:fµLl length protein

1,561.00 € 1561.0 EUR 1,561.00 €

1,561.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days