Skip to Content

ELISA Recombinant Xenopus tropicalis Voltage-gated hydrogen channel 1(hvcn1)

https://www.kxtbio.com/web/image/product.template/161634/image_1920?unique=7c948e0
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Xenopus tropicalis (Western clawed frog) (Silurana tropicalis) Uniprot NO.:Q5M8L8 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MAGCLRHFTSVGDDTKKKAWKEEDVEVAHEEEPKNTPHPFIASYSFRGALKWLFSSHKFQ IVIICLVILDALFVLVEVLLDLELLAEKVDHIIPEIFHYLSISVLSFFILEIAGKLYAFR LEFFHHKFEVFDAAIVVISFIIDIVYISREDIFNAVGLLILLRLWRVARIVNGIIVSVKT QAEDKIHRLKENQESLLEKVAHLEQQCAQQEQEIVRLQTLLQQHNVFPAS Protein Names:Recommended name: Voltage-gated hydrogen channel 1 Alternative name(s): Hydrogen voltage-gated channel 1 Short name= HV1 Gene Names:Name:hvcn1 Expression Region:1-230 Sequence Info:fµLl length protein

1,578.00 € 1578.0 EUR 1,578.00 €

1,578.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days