Skip to Content

ELISA Recombinant Xenopus tropicalis Zinc transporter 6(slc30a6)

https://www.kxtbio.com/web/image/product.template/161636/image_1920?unique=7c948e0
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Xenopus tropicalis (Western clawed frog) (Silurana tropicalis) Uniprot NO.:Q5I0B2 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MGTIYLFRKTQRSLLGKLTQEFRLVTADRRSWKILLFGAINVVCTGFLLTWCSSTNSMAL TAYTYLTIFDLFSLITCLISYWVMMKKPSPTYSFGFERFEVLSVFASTVLAQLGALFILK ESAERFVEQPEIHTGRLLVGTFVALCFNLFSmLSIRNKPFAYVSEAASTSWLQEHVADLS RSLCGIIPGLSSIFLPRMNPFVLIDIAGALALCITYmLIEINNYFAVDTASAIAIAVMTF GTMYPMSVYSGKVLLQTTPPHVIGQLDKLLREVSTLDGVLEVRNEHFWTLGFGTMAGSVH VRIRRDANEQMVLAHVTNRLNTLVSSLTVQIFKDEWARPVLASGAMPPNmLNIPDHHVIQ MPSLKSTMDELNPMTSTPSKPSSPPPEFAFNTPGKNMNPVILSNNQTRPSGVGFNYGTTP YTTTFNHGLGVPGIGNTQGLRTGLTNVANRYGTYTPGQFTQFKQ Protein Names:Recommended name: Zinc transporter 6 Short name= ZnT-6 Alternative name(s): Solute carrier family 30 member 6 Gene Names:Name:slc30a6 Synonyms:znt6 ORF Names:TEgg064j23.1, TTpA009a14.1 Expression Region:1-464 Sequence Info:fµLl length protein

1,825.00 € 1825.0 EUR 1,825.00 €

1,825.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days