ELISA Recombinant Xenopus tropicalis Type-1 angiotensin II receptor-associated protein-like(agtrap)
Quantity:50 µg. Other Quantitys are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Xenopus tropicalis (Western clawed frog) (Silurana tropicalis)
Uniprot NO.:Q5EBF8
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MELPAVNLKAIVFTHWLLTVFACMIDWLPKAYGLANITILAMGVWAIAQRDSIDAIFMFL IGLLLTILTDILLFALYFTEAEKASESGPLRDLFRFSSGMGIFSLLLKPLSCFFMYHMYR ERGGEYFVNLGFITLSRDRSSYQSIEHMDPPADQDNKLPSRTY
Protein Names:Recommended name: Type-1 angiotensin II receptor-associated protein-like
Gene Names:Name:agtrap ORF Names:TGas011p03.1
Expression Region:1-163
Sequence Info:fµLl length protein